Structure of PDB 6dcf Chain F Binding Site BS01

Receptor Information
>6dcf Chain F (length=297) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLPV
QQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGN
LGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEV
INKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQ
TDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dcf Rifamycin congeners kanglemycins are active against rifampicin-resistant bacteria via a distinct mechanism.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		L178 N237 R239 L240 R268 K272 D274 K277 Y279 K280 S282 T283 Y284 W287 W288 Q291 R295 R305 P307 H309 R408 V436 T437 R440 Q443
Binding residue
(residue number reindexed from 1)		L15 N74 R76 L77 R105 K109 D111 K114 Y116 K117 S119 T120 Y121 W124 W125 Q128 R132 R142 P144 H146 R240 V268 T269 R272 Q275
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dcf, PDBe:6dcf, PDBj:6dcf
PDBsum6dcf
PubMed30297823
UniProtA0QW02

[Back to BioLiP]