Structure of PDB 6cf2 Chain F Binding Site BS01

Receptor Information
>6cf2 Chain F (length=57) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERI
LSTYLGR
Ligand information
>6cf2 Chain G (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcuggacucguacuucgguacuggagaaacagcc
<<<<<..<<<<<<<....>>>>..>>>...>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cf2 Structure of an RNA Aptamer that Can Inhibit HIV-1 by Blocking Rev-Cognate RNA (RRE) Binding and Rev-Rev Association.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T34 R35 Q36 A37 R38 R39 N40 R41 R43 R44 R50
Binding residue
(residue number reindexed from 1)		T25 R26 Q27 A28 R29 R30 N31 R32 R34 R35 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cf2, PDBe:6cf2, PDBj:6cf2
PDBsum6cf2
PubMed30017564
UniProtP04616|REV_HV1B1 Protein Rev (Gene Name=rev)

[Back to BioLiP]