Structure of PDB 6c1u Chain F Binding Site BS01

Receptor Information
>6c1u Chain F (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARY
LGNTVDLSSFDFRTGKMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1u Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R166 S168 G169 L170 S171 M214
Binding residue
(residue number reindexed from 1)		R20 S22 G23 L24 S25 M68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1u, PDBe:6c1u, PDBj:6c1u
PDBsum6c1u
PubMed29567833
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]