Structure of PDB 6bzo Chain F Binding Site BS01

Receptor Information
>6bzo Chain F (length=326) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAK
RIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLR
LVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWI
RQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAK
EMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAV
SFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRE
RIRQIESKTMSKLRHPSRSQVLRDYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bzo Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		R301 L302 S305 K334 K339 Y341 K342 S344 T345 Y346 T348 W349 W350 Q353 R357 R367 P369 H371 E501 R502
Binding residue
(residue number reindexed from 1)		R100 L101 S104 K133 K138 Y140 K141 S143 T144 Y145 T147 W148 W149 Q152 R156 R166 P168 H170 E300 R301
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bzo, PDBe:6bzo, PDBj:6bzo
PDBsum6bzo
PubMed29480804
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]