Structure of PDB 6b27 Chain F Binding Site BS01

Receptor Information
>6b27 Chain F (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPAN
FVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRGFIRVSSGKK
RGLVPVDALTEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b27 Structural insights into binding of STAC proteins to voltage-gated calcium channels.
Resolution1.73 Å
Binding residue
(original residue number in PDB)
Y301 Q306 D310 N326 D328 W329 P342 N344 F345
Binding residue
(residue number reindexed from 1)
Y7 Q12 D16 N32 D34 W35 P48 N50 F51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b27, PDBe:6b27, PDBj:6b27
PDBsum6b27
PubMed29078335
UniProtQ6ZMT1|STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 (Gene Name=STAC2)

[Back to BioLiP]