Structure of PDB 6a4b Chain F Binding Site BS01

Receptor Information
>6a4b Chain F (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRAETFVFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLP
RVLDKLTLCMCPERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGF
LSRQEGPICLVAHNGFDYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGL
DRAHSHRKSYSLASLFHRYFQAEPSAASAEGDVHTLLLIFLHRAPELLAW
ADEQARSWAHIEPMYVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a4b Structural insights into the duplex DNA processing of TREX2
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E16 G19 L20 I77 N118 D121 Y122 R167 S169 Y170 S171 L172
Binding residue
(residue number reindexed from 1)		E12 G15 L16 I73 N114 D117 Y118 R157 S159 Y160 S161 L162
Enzymatic activity
Enzyme Commision number 3.1.11.2: exodeoxyribonuclease III.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6a4b, PDBe:6a4b, PDBj:6a4b
PDBsum6a4b
PubMed30357414
UniProtQ9R1A9|TREX2_MOUSE Three prime repair exonuclease 2 (Gene Name=Trex2)

[Back to BioLiP]