Structure of PDB 5xs0 Chain F Binding Site BS01

Receptor Information
>5xs0 Chain F (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINL
ANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDV
GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xs0 Structural Basis of Homology-Directed DNA Repair Mediated by RAD52
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L132 K133 S134 L137
Binding residue
(residue number reindexed from 1)		L108 K109 S110 L113
Binding affinityPDBbind-CN: Kd=5.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0045002 double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xs0, PDBe:5xs0, PDBj:5xs0
PDBsum5xs0
PubMed30428330
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]