Structure of PDB 5vi8 Chain F Binding Site BS01

Receptor Information

>5vi8 Chain F (length=319) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

AKKAPAKRAAKSAAAKAADSVRAYLKQIGKVALLNAEEEVELAKRIEAGL
YATQKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRLVVSLA
KRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITR
AMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITP
EKVLEIQQYAREPISLDQTIGDDSQLGDFIEDSEAVVAVDAVSFTLLQDQ
LQSVLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESK
TMSKLRHPSRSQVLRDYLD

Ligand information

>5vi8 Chain O (length=31)

gcttgacaaaagtgttaaattgtgctatact

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5vi8 Structural insights into the mycobacteria transcription initiation complex from analysis of X-ray crystal structures.
• Resolution: 2.76 Å
• Binding residue (original residue number in PDB): N237 R239 L240 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 P307 V308 H309 R408 V436 T437 R440 Q443
• Binding residue (residue number reindexed from 1): N92 R94 L95 R123 K127 F128 D129 K132 Y134 K135 S137 T138 Y139 T141 W142 W143 Q146 R150 R160 P162 V163 H164 R261 V289 T290 R293 Q296

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vi8, PDBe:5vi8, PDBj:5vi8
• PDBsum: 5vi8
• PubMed: 28703128
• UniProt: A0QW02