Structure of PDB 5vi5 Chain F Binding Site BS01

Receptor Information
>5vi5 Chain F (length=314) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYAT
QKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRY
TGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMA
DQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKV
LEIQQYAREPISLDQTIDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVL
ETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKL
RHPSRSQVLRDYLD
Ligand information
>5vi5 Chain O (length=49) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttgacaaaagtgttaaattgtgctatactgggagccgtcacggatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vi5 Structural insights into the mycobacteria transcription initiation complex from analysis of X-ray crystal structures.
Resolution3.196 Å
Binding residue
(original residue number in PDB)		D164 V166 L170 L178 N237 R239 L240 S243 K246 F255 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 V308 H309 R408 V436 T437 R440 Q443
Binding residue
(residue number reindexed from 1)		D16 V18 L22 L30 N89 R91 L92 S95 K98 F107 R120 K124 F125 D126 K129 Y131 K132 S134 T135 Y136 T138 W139 W140 Q143 R147 R157 V160 H161 R256 V284 T285 R288 Q291
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vi5, PDBe:5vi5, PDBj:5vi5
PDBsum5vi5
PubMed28703128
UniProtA0QW02

[Back to BioLiP]