Structure of PDB 5uhe Chain F Binding Site BS01

Receptor Information

>5uhe Chain F (length=322) Species: 83332 (Mycobacterium tuberculosis H37Rv)

DESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAG
LYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSL
AKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAIT
RAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDIT
PEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLL
QDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQI
ESKTMSKLRHPSRSQVLRDYLD

Ligand information

>5uhe Chain H (length=23)

tataatgggagctgtcacggatg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5uhe Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.
• Resolution: 4.039 Å
• Binding residue (original residue number in PDB): D226 V228 R229 L232 G236 N299 R301 L302 F335 D336 K339 Y341 K342 S344 T345 Y346 T348 W349 W350 Q353
• Binding residue (residue number reindexed from 1): D20 V22 R23 L26 G30 N93 R95 L96 F129 D130 K133 Y135 K136 S138 T139 Y140 T142 W143 W144 Q147

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0009415 response to water
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:5uhe, PDBe:5uhe, PDBj:5uhe
• PDBsum: 5uhe
• PubMed: 28392175
• UniProt: P9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)