Structure of PDB 5uhd Chain F Binding Site BS01

Receptor Information
>5uhd Chain F (length=320) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAG
LYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSL
AKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAIT
RAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDIT
PEKVLEIQQYAREPISLDQTIEGDSQLGDFIEDSEAVVAVDAVSFTLLQD
QLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIES
KTMSKLRHPSRSQVLRDYLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uhd Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.
Resolution4.01 Å
Binding residue
(original residue number in PDB)		D226 V228 R229 L232 G236 N299 R301 L302 D336 K339 Y341 K342 S344 T345 Y346 T348 W349
Binding residue
(residue number reindexed from 1)		D20 V22 R23 L26 G30 N93 R95 L96 D130 K133 Y135 K136 S138 T139 Y140 T142 W143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uhd, PDBe:5uhd, PDBj:5uhd
PDBsum5uhd
PubMed28392175
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]