Structure of PDB 5u91 Chain F Binding Site BS01

Receptor Information

>5u91 Chain F (length=320) Species: 32630 (synthetic construct)

EVRKNLMDVFRDRPAFSEHTWEMLLSVCRSWAAWCKLNNRKWFPAEPEDV
RDYLLHLQARGLAVKTIQQHLCRLNMLHRRSGLPRPSDSNAVSLVMRRIR
KENVDAGERTKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGVAYNTL
LRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLV
ERWISVSGVADDPNNYLFCRVRRYGVAAPSATSQLSTYALQRIFEATHRL
IYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTTVNSV
MNFIRNLDSETGAMVRLLED

Ligand information

>5u91 Chain G (length=37)

cgacaacatcctattacaccctatatgccaacatggc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5u91 Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.
• Resolution: 3.104 Å
• Binding residue (original residue number in PDB): M44 S47 R50 L83 A84 K86 T87 Q90 K122 T131 K132 Q156 R159 R173 K201 R241 V242 R243 R244 L256 S257 R282 Y283 H289 R292 T316 T317 S320 F324
• Binding residue (residue number reindexed from 1): M23 S26 R29 L62 A63 K65 T66 Q69 K101 T110 K111 Q135 R138 R152 K180 R220 V221 R222 R223 L235 S236 R261 Y262 H268 R271 T295 T296 S299 F303

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 22:47:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5u91', asym_id = 'F', bs = 'BS01', title = 'Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5u91', asym_id='F', bs='BS01', title='Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0006310,0015074', uniprot = '', pdbid = '5u91', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0006310,0015074', uniprot='', pdbid='5u91', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>