Structure of PDB 5tsx Chain F Binding Site BS01

Receptor Information

>5tsx Chain F (length=214) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPGQMREPRGSDIA
GTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQ
GPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKAL
GPGATLEEMMTACQ

Ligand information

>5tsx Chain T (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SPSGVFTFG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5tsx HIV-1 CA hexamer with NUP153 peptide - P1 crystal form
Resolution	1.899 Å
Binding residue (original residue number in PDB)	P34 I37 R143 R173 Q176 A177
Binding residue (residue number reindexed from 1)	P34 I37 R138 R168 Q171 A172

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:5tsx, PDBe:5tsx, PDBj:5tsx
PDBsum	5tsx
PubMed
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]