Structure of PDB 5odn Chain F Binding Site BS01

Receptor Information
>5odn Chain F (length=105) Species: 309807 (Salinibacter ruber DSM 13855) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTDEVQNTEWH
DVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTRYSTEVKAQE
MMFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5odn Single-strand binding protein
Resolution2.598 Å
Binding residue
(original residue number in PDB)		N13 L14 G15 S33 A35 N37 T51 W53
Binding residue
(residue number reindexed from 1)		N13 L14 G15 S33 A35 N37 T47 W49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0051096 positive regulation of helicase activity
Cellular Component
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5odn, PDBe:5odn, PDBj:5odn
PDBsum5odn
PubMed
UniProtQ2S565

[Back to BioLiP]