Structure of PDB 5o9g Chain F Binding Site BS01

Receptor Information
>5o9g Chain F (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>5o9g Chain I (length=162) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcgattaacg
atgctgggcata
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o9g Nucleosome-Chd1 structure and implications for chromatin remodelling.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		R35 R45 S47 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R11 R21 S23 R54 K55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o9g, PDBe:5o9g, PDBj:5o9g
PDBsum5o9g
PubMed29019976
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]