Structure of PDB 5nnp Chain F Binding Site BS01

Receptor Information

>5nnp Chain F (length=178) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDIRLLRPSDIPLIQHANLENLPENYFLKYYLYHALSWPQLSFVAVDVSR
PAKSPYDYPKIVGYVLAKMEEEPADGVPHGHITSLSVMRTHRRLGIAEKL
MRQSQLAMVETYNAHYVSLHVRVSNKAAIHLYRDTLGFKTEKVEAKYYAD
GEDAYCMKLDLTALREQIAAQREKELEE

Ligand information

>5nnp Chain L (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SESS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5nnp Structural basis of HypK regulating N-terminal acetylation by the NatA complex.
Resolution	2.602 Å
Binding residue (original residue number in PDB)	E24 N25 Y26 Y30 T83 Y147 Y148
Binding residue (residue number reindexed from 1)	E24 N25 Y26 Y30 T83 Y147 Y148

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004596	peptide alpha-N-acetyltransferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups

	Biological Process
GO:0006474	N-terminal protein amino acid acetylation

	Cellular Component
GO:0031415	NatA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nnp, PDBe:5nnp, PDBj:5nnp
PDBsum	5nnp
PubMed	28585574
UniProt	G0SEE8

[Back to BioLiP]