Structure of PDB 5n74 Chain F Binding Site BS01

Receptor Information
>5n74 Chain F (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDI
LYA
Ligand information
>5n74 Chain M (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRLRPPTPLSQLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n74 Short Linear Sequence Motif LxxPTPh Targets Diverse Proteins to Growing Microtubule Ends.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R214 F218 R222 E225 L246 Y247
Binding residue
(residue number reindexed from 1)		R19 F23 R27 E30 L51 Y52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:5n74, PDBe:5n74, PDBj:5n74
PDBsum5n74
PubMed28552577
UniProtH0XPX6

[Back to BioLiP]