Structure of PDB 5lsj Chain F Binding Site BS01

Receptor Information
>5lsj Chain F (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTLGSSQNE
VLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKV
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lsj Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		S203 L204
Binding residue
(residue number reindexed from 1)		S1 L2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007059 chromosome segregation
GO:0051301 cell division
Cellular Component
GO:0000444 MIS12/MIND type complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lsj, PDBe:5lsj, PDBj:5lsj
PDBsum5lsj
PubMed27881301
UniProtQ9H410|DSN1_HUMAN Kinetochore-associated protein DSN1 homolog (Gene Name=DSN1)

[Back to BioLiP]