Structure of PDB 5lm7 Chain F Binding Site BS01

Receptor Information
>5lm7 Chain F (length=84) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSMDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSR
VESALNPIDLTVLAEYHKQIESNLQRIERKNQRT
Ligand information
>5lm7 Chain G (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuuuaacauuaagcccugaagaagggc
............<<<<<.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lm7 Structural basis for lambda N-dependent processive transcription antitermination.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		M1 D2 A3 Q4 R7 R10 R11 Q15 W18
Binding residue
(residue number reindexed from 1)		M4 D5 A6 Q7 R10 R13 R14 Q18 W21
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5lm7, PDBe:5lm7, PDBj:5lm7
PDBsum5lm7
PubMed28452979
UniProtP03045|REGN_LAMBD Antitermination protein N (Gene Name=N)

[Back to BioLiP]