Structure of PDB 5ivx Chain F Binding Site BS01

Receptor Information

>5ivx Chain F (length=234) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYD
VDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVF
FGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDH
VELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHF
RCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR

Ligand information

>5ivx Chain P (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RGPGRAFVTI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ivx An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	E29 Y49 L94 G95 H96
Binding residue (residue number reindexed from 1)	E29 Y49 L94 G95 H96

External links

PDB	RCSB:5ivx, PDBe:5ivx, PDBj:5ivx
PDBsum	5ivx
PubMed	28508865

[Back to BioLiP]