Structure of PDB 5ic4 Chain F Binding Site BS01

Receptor Information
>5ic4 Chain F (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHI
LTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ic4 Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		Y204 S205 W206 R207 N208 W214 S249 F250
Binding residue
(residue number reindexed from 1)		Y19 S20 W21 R22 N23 W29 S64 F65
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ic4, PDBe:5ic4, PDBj:5ic4
PDBsum5ic4
PubMed27367566
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]