Structure of PDB 5eel Chain F Binding Site BS01

Receptor Information
>5eel Chain F (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQK
VKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHC
CTRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eel Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
Resolution2.47 Å
Binding residue
(original residue number in PDB)
R438 K478 H479 Y480 L481 M495
Binding residue
(residue number reindexed from 1)
R12 K52 H53 Y54 L55 M69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5eel, PDBe:5eel, PDBj:5eel
PDBsum5eel
PubMed27257138
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]