Structure of PDB 5e6i Chain F Binding Site BS01

Receptor Information
>5e6i Chain F (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKA
GELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGPGGSSNTGKLI
FGQGTTLQVKPDIQNPDPAVYQLRDSKSSDVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Ligand information
>5e6i Chain O (length=9) Species: 947055 (Influenza A virus (A/Boston/2747243M/2009(H1N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GILGFVFTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e6i Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
Resolution4.0 Å
Binding residue
(original residue number in PDB)		N97 T98
Binding residue
(residue number reindexed from 1)		N95 T96
Enzymatic activity
Enzyme Commision number ?
External links