Structure of PDB 5dsc Chain F Binding Site BS01

Receptor Information

>5dsc Chain F (length=211) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TQTPSPVSAAVGGTVTISCRSRQRVYLGDWLSWFQKKPGQPPKLLIYDAS
FRGDGVSSRFSGSGSGTHFTLTISGVQCDDAATYYCLGGYYDDADDTFGG
GTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVD
GTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTT
SVVQSFNRGDC

Ligand information

>5dsc Chain M (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GKGSG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dsc Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	Y28 W32 Y92 Y93 D94 D95 D96
Binding residue (residue number reindexed from 1)	Y26 W30 Y90 Y91 D92 D93 D96

External links

PDB	RCSB:5dsc, PDBe:5dsc, PDBj:5dsc
PDBsum	5dsc
PubMed	26778617

[Back to BioLiP]