Structure of PDB 4z88 Chain F Binding Site BS01

Receptor Information
>4z88 Chain F (length=67) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYW
GELRGRRGYVPHNMVSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F1324 Y1326 P1333 N1334 D1336 E1340 D1359 H1375 N1376
Binding residue
(residue number reindexed from 1)		F11 Y13 P20 N21 D23 E27 D46 H62 N63
Enzymatic activity
Enzyme Commision number ?
External links