Structure of PDB 4ylo Chain F Binding Site BS01

Receptor Information
>4ylo Chain F (length=497) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGIN
QVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAENSIDPEL
AREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQF
DYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWF
NAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMS
IGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAV
DKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRI
SRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDED
SHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGID
MNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Ligand information
>4ylo Chain 1 (length=49) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acttgacatccacctcacgtatgctataatgtgtgcagtctgacgcggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ylo Crystal Structures of the E. coli Transcription Initiation Complexes with a Complete Bubble.
Resolution6.0 Å
Binding residue
(original residue number in PDB)		V98 R99 M102 M105 N383 R385 L386 I388 S389 K392 R423 Y425 K426 S428 T429 Y430 T432 W433 W434 Q437 R451 P453 R554 V582 T583 R586
Binding residue
(residue number reindexed from 1)		V20 R21 M24 M27 N267 R269 L270 I272 S273 K276 R307 Y309 K310 S312 T313 Y314 T316 W317 W318 Q321 R335 P337 R438 V466 T467 R470
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009408 response to heat
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ylo, PDBe:4ylo, PDBj:4ylo
PDBsum4ylo
PubMed25866247
UniProtP00579|RPOD_ECOLI RNA polymerase sigma factor RpoD (Gene Name=rpoD)

[Back to BioLiP]