Structure of PDB 4yk9 Chain F Binding Site BS01

Receptor Information
>4yk9 Chain F (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQSNRELVVDFLSYKLSQKGYSWSQFSDVAAVKQALREAGDEFELRYRRA
FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
VDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG
Ligand information
>4yk9 Chain B (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIWIAQELRSRGDSFNAYYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yk9 The structure of a Bcl-xL/Bim fragment complex: implications for Bim function.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R103 S106 D107 S110
Binding residue
(residue number reindexed from 1)		R49 S52 D53 S56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yk9, PDBe:4yk9, PDBj:4yk9
PDBsum4yk9
PubMed
UniProtQ64373|B2CL1_MOUSE Bcl-2-like protein 1 (Gene Name=Bcl2l1)

[Back to BioLiP]