Structure of PDB 4y18 Chain F Binding Site BS01

Receptor Information
>4y18 Chain F (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEF
VCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRN
HQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEL
SSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALY
QCQELDTYLIPQIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y18 Structure of BRCA1-BRCT/Abraxas Complex Reveals Phosphorylation-Dependent BRCT Dimerization at DNA Damage Sites.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		S1655 G1656 P1659 R1699 K1702 N1774 M1775
Binding residue
(residue number reindexed from 1)		S10 G11 P14 R54 K57 N129 M130
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4y18, PDBe:4y18, PDBj:4y18
PDBsum4y18
PubMed26778126
UniProtP38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]