Structure of PDB 4xlq Chain F Binding Site BS01

Receptor Information
>4xlq Chain F (length=345) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIR
EVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAR
EGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFE
YKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQL
QQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSF
YGDFIPDENLPSPVEAAAQSLLSEELEKALSKLSEREAMVLKLRKGLIDG
REHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xlq Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
Resolution4.6 Å
Binding residue
(original residue number in PDB)		N206 R208 L209 R237 K241 F242 E243 R246 F248 K249 S251 T252 Y253 T255 W256 W257 Q260 R264 R274 P276 V277 H278 V407 E410 R411 Q414
Binding residue
(residue number reindexed from 1)		N113 R115 L116 R144 K148 F149 E150 R153 F155 K156 S158 T159 Y160 T162 W163 W164 Q167 R171 R181 P183 V184 H185 V314 E317 R318 Q321
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xlq, PDBe:4xlq, PDBj:4xlq
PDBsum4xlq
PubMed26349032
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]