Structure of PDB 4xlp Chain F Binding Site BS01

Receptor Information
>4xlp Chain F (length=345) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIR
EVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAR
EGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFE
YKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQL
QQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSF
YGDFIPDENLPSPVEAAAQSLLSEELEKALSKLSEREAMVLKLRKGLIDG
REHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xlp Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		A205 N206 L209 K241 F242 E243 R246 F248 K249 S251 T252 Y253 T255 W257 R264 R274 P276 H278 V407 T408 E410 R411
Binding residue
(residue number reindexed from 1)		A112 N113 L116 K148 F149 E150 R153 F155 K156 S158 T159 Y160 T162 W164 R171 R181 P183 H185 V314 T315 E317 R318
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xlp, PDBe:4xlp, PDBj:4xlp
PDBsum4xlp
PubMed26349032
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]