Structure of PDB 4qh7 Chain F Binding Site BS01

Receptor Information
>4qh7 Chain F (length=83) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWH
CIVGRNFGSYVTHETRHFIYFYLGQVAILLFKS
Ligand information
>4qh7 Chain G (length=11) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYTICAGTQTD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qh7 The Mechanism of Dynein Light Chain LC8-mediated Oligomerization of the Ana2 Centriole Duplication Factor.
Resolution1.829 Å
Binding residue
(original residue number in PDB)
I34 E35 K36
Binding residue
(residue number reindexed from 1)
I29 E30 K31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0007017 microtubule-based process
GO:0007283 spermatogenesis
GO:0007290 spermatid nucleus elongation
GO:0007291 sperm individualization
GO:0007476 imaginal disc-derived wing morphogenesis
GO:0008407 chaeta morphogenesis
GO:0022416 chaeta development
GO:0034454 microtubule anchoring at centrosome
GO:0035220 wing disc development
GO:0045892 negative regulation of DNA-templated transcription
GO:0048477 oogenesis
GO:0051017 actin filament bundle assembly
GO:0141006 piRNA-mediated retrotransposon silencing by heterochromatin formation
GO:1904801 positive regulation of neuron remodeling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005814 centriole
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:0090571 RNA polymerase II transcription repressor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4qh7, PDBe:4qh7, PDBj:4qh7
PDBsum4qh7
PubMed24920673
UniProtQ24117|DYL1_DROME Dynein light chain 1, cytoplasmic (Gene Name=ctp)

[Back to BioLiP]