Structure of PDB 4q5s Chain F Binding Site BS01

Receptor Information
>4q5s Chain F (length=338) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLI
REVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIA
REGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKF
EYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQ
LQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPFYGDFIP
DEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLE
EVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q5s Structural basis of transcription initiation by bacterial RNA polymerase holoenzyme.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		V81 R82 L85 H86 G89 N191 R193 L194 S197 K200 F209 K226 F227 E228 R231 F233 K234 S236 T237 Y238 T240 W241
Binding residue
(residue number reindexed from 1)		V4 R5 L8 H9 G12 N114 R116 L117 S120 K123 F132 K149 F150 E151 R154 F156 K157 S159 T160 Y161 T163 W164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4q5s, PDBe:4q5s, PDBj:4q5s
PDBsum4q5s
PubMed24973216
UniProtQ5SKW1

[Back to BioLiP]