Structure of PDB 4n78 Chain F Binding Site BS01

Receptor Information
>4n78 Chain F (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEE
TKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDI
HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDI
GHGVKW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n78 The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
Resolution2.43 Å
Binding residue
(original residue number in PDB)		R106 G110
Binding residue
(residue number reindexed from 1)		R107 G111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008093 cytoskeletal anchor activity
GO:0017124 SH3 domain binding
GO:0019900 kinase binding
GO:0031267 small GTPase binding
GO:0031625 ubiquitin protein ligase binding
GO:0035591 signaling adaptor activity
GO:0042802 identical protein binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000423 mitophagy
GO:0001764 neuron migration
GO:0007010 cytoskeleton organization
GO:0007399 nervous system development
GO:0008154 actin polymerization or depolymerization
GO:0010592 positive regulation of lamellipodium assembly
GO:0016477 cell migration
GO:0016601 Rac protein signal transduction
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0061001 regulation of dendritic spine morphogenesis
GO:0070309 lens fiber cell morphogenesis
GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005912 adherens junction
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031209 SCAR complex
GO:0032433 filopodium tip
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0070161 anchoring junction
GO:0098858 actin-based cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4n78, PDBe:4n78, PDBj:4n78
PDBsum4n78
PubMed24439376
UniProtQ9NYB9|ABI2_HUMAN Abl interactor 2 (Gene Name=ABI2)

[Back to BioLiP]