Structure of PDB 4m9v Chain F Binding Site BS01

Receptor Information
>4m9v Chain F (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVN
RHLKVHQNKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m9v DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
Resolution0.969 Å
Binding residue
(original residue number in PDB)		S156 R157 R159 R160 S181 Q182
Binding residue
(residue number reindexed from 1)		S22 R23 R25 R26 S47 Q48
Binding affinityPDBbind-CN: Kd=7nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m9v, PDBe:4m9v, PDBj:4m9v
PDBsum4m9v
PubMed24236546
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]