Structure of PDB 4m7a Chain F Binding Site BS01

Receptor Information

AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKL
GLTVIRGTILVSLSSA

Ligand information

guuuu

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	4m7a Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
Resolution	2.781 Å
Binding residue (original residue number in PDB)	Q57 L58
Binding residue (residue number reindexed from 1)	Q32 L33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000398	mRNA splicing, via spliceosome
GO:0000956	nuclear-transcribed mRNA catabolic process
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0008033	tRNA processing
GO:0008380	RNA splicing
GO:0030490	maturation of SSU-rRNA

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005688	U6 snRNP
GO:0005730	nucleolus
GO:0005732	sno(s)RNA-containing ribonucleoprotein complex
GO:0005737	cytoplasm
GO:0032991	protein-containing complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071004	U2-type prespliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0097526	spliceosomal tri-snRNP complex
GO:1990726	Lsm1-7-Pat1 complex

External links

PDB	RCSB:4m7a, PDBe:4m7a, PDBj:4m7a
PDBsum	4m7a
PubMed	24240276
UniProt	P53905\|LSM7_YEAST U6 snRNA-associated Sm-like protein LSm7 (Gene Name=LSM7)