Structure of PDB 4lbf Chain F Binding Site BS01

Receptor Information
>4lbf Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ACYCRIPACIAGERRYGTCAYQGRAWAFCC
Ligand information
>4lbf Chain E (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ACYCRIPACIAGERRYGTCAWAFCC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lbf Single, Double and Quadruple Alanine Substitutions at Oligomeric Interfaces Identify Hydrophobicity as the Key Determinant of Human Neutrophil Alpha Defensin HNP1 Function.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		A1 C2 Y16 C30
Binding residue
(residue number reindexed from 1)		A1 C2 Y16 C30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006952 defense response
Cellular Component
GO:0005576 extracellular region

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lbf, PDBe:4lbf, PDBj:4lbf
PDBsum4lbf
PubMed24236072
UniProtP59665|DEF1_HUMAN Neutrophil defensin 1 (Gene Name=DEFA1)

[Back to BioLiP]