Structure of PDB 4l1u Chain F Binding Site BS01

Receptor Information
>4l1u Chain F (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKP
VYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFT
ESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l1u Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
Resolution2.424 Å
Binding residue
(original residue number in PDB)		G390 G392 Y400 F441 S443 N444
Binding residue
(residue number reindexed from 1)		G42 G44 Y52 F93 S95 N96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4l1u, PDBe:4l1u, PDBj:4l1u
PDBsum4l1u
PubMed24101474
UniProtQ92541|RTF1_HUMAN RNA polymerase-associated protein RTF1 homolog (Gene Name=RTF1)

[Back to BioLiP]