Structure of PDB 4kvm Chain F Binding Site BS01

Receptor Information
>4kvm Chain F (length=153) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKG
RVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMV
EVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHK
DFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kvm Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
Resolution2.597 Å
Binding residue
(original residue number in PDB)		E24 Y26 T74 Y138 Y139
Binding residue
(residue number reindexed from 1)		E24 Y26 T74 Y138 Y139
Enzymatic activity
Enzyme Commision number 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
Biological Process
GO:0006474 N-terminal protein amino acid acetylation
Cellular Component
GO:0031415 NatA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kvm, PDBe:4kvm, PDBj:4kvm
PDBsum4kvm
PubMed23912279
UniProtQ9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 (Gene Name=ard1)

[Back to BioLiP]