Structure of PDB 4jzo Chain F Binding Site BS01

Receptor Information
>4jzo Chain F (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVLTQPPSVSVSPGQTARITCSGDKLGDKYASWYQQKPGQSPVLVIYQDN
KRPSEIPARFSGSNSGNTATLTISGAQAMDEADYYCQAWDSNTGVFGTGT
KLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN
ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS
SPVTKSFNRG
Ligand information
>4jzo Chain K (length=11) Species: 11108 (Hepatitis C virus (isolate H)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GWLAGLFYQHK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jzo Structural basis of HCV neutralization by human monoclonal antibodies resistant to viral neutralization escape.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		G28 D29 K30 Y31 Q49 D50 W90 N93
Binding residue
(residue number reindexed from 1)		G27 D28 K29 Y30 Q48 D49 W89 N92
External links