Structure of PDB 4iqr Chain F Binding Site BS01

Receptor Information
>4iqr Chain F (length=314) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQ
AEVLSRSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPL
DDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSR
VSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRS
QVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGM
AKIDNLLQEMLLGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iqr Multidomain integration in the structure of the HNF-4 alpha nuclear receptor complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y63 R76 R80 Q122 E124 R125 R127 I128 S129
Binding residue
(residue number reindexed from 1)		Y15 R28 R32 Q74 E76 R77 R79 I80 S81
Binding affinityPDBbind-CN: Kd=80nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4iqr, PDBe:4iqr, PDBj:4iqr
PDBsum4iqr
PubMed23485969
UniProtP41235|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)

[Back to BioLiP]