Structure of PDB 4gl9 Chain F Binding Site BS01

Receptor Information
>4gl9 Chain F (length=126) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIR
DSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVL
KLVHHYMAYYIYGEKIPLVLSRPLSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gl9 SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
R71 S73 S74 T81 K91 N92 L93 R94 D107 R109 Q112 Y142 Y143 I144
Binding residue
(residue number reindexed from 1)
R50 S52 S53 T60 K70 N71 L72 R73 D86 R88 Q91 Y109 Y110 I111
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4gl9, PDBe:4gl9, PDBj:4gl9
PDBsum4gl9
PubMed23454976
UniProtO35718|SOCS3_MOUSE Suppressor of cytokine signaling 3 (Gene Name=Socs3)

[Back to BioLiP]