Structure of PDB 4bq7 Chain F Binding Site BS01

Receptor Information
>4bq7 Chain F (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKITI
IFKAHHGCTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVEYVEMHA
RYIGTTVFVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPLSER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bq7 Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
Resolution6.601 Å
Binding residue
(original residue number in PDB)
H170 L171 R172 T173 F174 G225 C226 R274 Y275 G277 T290 L291 A292 I293 R294 M295 P296 E297 D298 L299 C312
Binding residue
(residue number reindexed from 1)
H2 L3 R4 T5 F6 G57 C58 R101 Y102 G104 T117 L118 A119 I120 R121 M122 P123 E124 D125 L126 C139
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4bq7, PDBe:4bq7, PDBj:4bq7
PDBsum4bq7
PubMed23744777
UniProtQ6NW40|RGMB_HUMAN Repulsive guidance molecule B (Gene Name=RGMB)

[Back to BioLiP]