Structure of PDB 4auw Chain F Binding Site BS01

Receptor Information
>4auw Chain F (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKR
VQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4auw Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R249 Q253 R256 K297 S298
Binding residue
(residue number reindexed from 1)		R40 Q44 R47 K88 S89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4auw, PDBe:4auw, PDBj:4auw
PDBsum4auw
PubMed17671361
UniProtP54841|MAFB_MOUSE Transcription factor MafB (Gene Name=Mafb)

[Back to BioLiP]