Structure of PDB 3rbq Chain F Binding Site BS01

Receptor Information
>3rbq Chain F (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPP
NAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLK
SFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVD
DRLVMHNKADYSYSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rbq UNC119 is required for G protein trafficking in sensory neurons.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F88 F91 I105 K107 P108 A125 G126 R127 F128 V129 Y131 E163 S218 Y220 N230
Binding residue
(residue number reindexed from 1)
F29 F32 I46 K48 P49 A52 G53 R54 F55 V56 Y58 E90 S145 Y147 N157
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3rbq, PDBe:3rbq, PDBj:3rbq
PDBsum3rbq
PubMed21642972
UniProtQ13432|U119A_HUMAN Protein unc-119 homolog A (Gene Name=UNC119)

[Back to BioLiP]