Structure of PDB 3r0h Chain F Binding Site BS01

Receptor Information
>3r0h Chain F (length=198) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEPATAEIKPNKKILIELKVEKKPMGVIVCGGKNNHVTTGCVITHVYPEG
QVAADKRLKIFDHICDINGTPIHVGSMTTLKVHQLFHTTYEKAVTLTVFR
ADPPELEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQ
RGDIITKFNGDALEGLPFQVCYALFKGANGKVSMEVTRPKPTLRTEAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r0h The INAD scaffold is a dynamic, redox-regulated modulator of signaling in the Drosophila eye
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E594 L595 G596 L597 S598 I612 F642 Y646 F649
Binding residue
(residue number reindexed from 1)		E120 L121 G122 L123 S124 I138 F168 Y172 F175
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3r0h, PDBe:3r0h, PDBj:3r0h
PDBsum3r0h
PubMed21703451
UniProtQ24008|INAD_DROME Inactivation-no-after-potential D protein (Gene Name=inaD)

[Back to BioLiP]