Structure of PDB 3otp Chain F Binding Site BS01

Receptor Information
>3otp Chain F (length=378) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMPSLAPMLEKVMPSVVSINVEQKFMALGSGVIIDADKGYVVTNNHVVDN
ATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALR
VGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGN
AGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQ
VKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDV
ITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSFN
GIEGAEMSNKGKDQGVVVNNVKTGTPAAQILKKGDVIIGANQQAVKNIAE
LRKVLDSKPSVLALNIQRGDSTIYLLMQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3otp Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
Resolution3.76 Å
Binding residue
(original residue number in PDB)
H105 L190 R207 G208 A210 T226 I228 L229 A230 E264 L265 G266 I267 M268 G269 S291 F321 L324 R325
Binding residue
(residue number reindexed from 1)
H46 L131 R148 G149 A151 T167 I169 L170 A171 E205 L206 G207 I208 M209 G210 S232 F262 L265 R266
Enzymatic activity
Enzyme Commision number 3.4.21.107: peptidase Do.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
Biological Process
GO:0006457 protein folding
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0006979 response to oxidative stress
GO:0009266 response to temperature stimulus
GO:0009408 response to heat
GO:0061077 chaperone-mediated protein folding
Cellular Component
GO:0005886 plasma membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3otp, PDBe:3otp, PDBj:3otp
PDBsum3otp
PubMed21458668
UniProtP0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP (Gene Name=degP)

[Back to BioLiP]