Structure of PDB 3m85 Chain F Binding Site BS01

Receptor Information
>3m85 Chain F (length=246) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEKLIVDGLRLDGRKFDELRPIKIEASVLKRADGSCYLEMGKNKVIAAVF
GPREVHPEHLQDPSKAIIRYRYNMAPFSVEERKRPGPDRRSIEISKVSKE
AFEAVIMKELFPRSAIDIFVEVLQADAGSRTACLNAASVALVDAGVPMKG
MITSVAVGKADGQLVLDPMKEEDNFGEADMPFAFLIRNGKIESIALLQMD
GRMTRDEVKQAIELAKKGALQIYEMQREAILRRYIEVGEEMDEITE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m85 Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)		M81 V86 K90 R96 D133
Binding residue
(residue number reindexed from 1)		M74 V79 K83 R89 D126
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
Cellular Component
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3m85, PDBe:3m85, PDBj:3m85
PDBsum3m85
PubMed20392821
UniProtO29757|RRP41_ARCFU Exosome complex component Rrp41 (Gene Name=rrp41)

[Back to BioLiP]