Structure of PDB 3kwq Chain F Binding Site BS01

Receptor Information
>3kwq Chain F (length=83) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>3kwq Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kwq Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 G48 K79 T80
Binding residue
(residue number reindexed from 1)		R16 R26 I27 G29 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:3kwq, PDBe:3kwq, PDBj:3kwq
PDBsum3kwq
PubMed20100606
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]