Structure of PDB 3dpq Chain F Binding Site BS01

Receptor Information

>3dpq Chain F (length=214) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIA

Ligand information

>3dpq Chain G (length=12) Species: 37000 (Pyrrhocoris apterus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KLYALPRPTPPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3dpq Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	T403 M404 F426 S427 A429 Q433 A435 T437
Binding residue (residue number reindexed from 1)	T15 M16 F38 S39 A41 Q45 A47 T49

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:3dpq, PDBe:3dpq, PDBj:3dpq
PDBsum	3dpq
PubMed	19103929
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]