Structure of PDB 3co7 Chain F Binding Site BS01

Receptor Information

>3co7 Chain F (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSN
SSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP

Ligand information

>3co7 Chain D (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcttgtttacattttg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3co7 Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
Resolution	2.91 Å
Binding residue (original residue number in PDB)	L183 R214 H215 S218 R225 S234 S235 W237
Binding residue (residue number reindexed from 1)	L29 R60 H61 S64 R71 S80 S81 W83
Binding affinity	PDBbind-CN: Kd=12nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3co7, PDBe:3co7, PDBj:3co7
PDBsum	3co7
PubMed	18786403
UniProt	Q12778\|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]