Structure of PDB 3co7 Chain F Binding Site BS01

Receptor Information
>3co7 Chain F (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSN
SSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3co7 Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
Resolution2.91 Å
Binding residue
(original residue number in PDB)
L183 R214 H215 S218 R225 S234 S235 W237
Binding residue
(residue number reindexed from 1)
L29 R60 H61 S64 R71 S80 S81 W83
Binding affinityPDBbind-CN: Kd=12nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3co7, PDBe:3co7, PDBj:3co7
PDBsum3co7
PubMed18786403
UniProtQ12778|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]